Metalotionein

Из Википедије, слободне енциклопедије
Иди на навигацију Иди на претрагу
Metalotioneinska superfamilija (biljke)
Metallothionein 2kak.png
Beta-E-domen pšeničnog Ec-1 metalotioneina vezanog za jene cinka. Cisteini su obojeni žuto, a cink purpurno. (PDB: 2KAK​)[1]
Идентификатори
Симбол Metallothionein_sfam
Пфам PF00131
ИнтерПро IPR003019
Yeast MT
Metallothionein 1aqs.png
Metalotionein vrste Saccharomyces cerevisiae vezan za jone bakra. Cisteini su obojeni žuto, a bakar smeđe. (PDB: 1AQS​)
Identifikatori
SimbolMetalotionein kvasca
PfamPF11403
Pfam klanCL0461
InterProIPR022710
Cyanobacterial SmtA
Metallothionein 1jjd.png
Cijanobakterijski SmtA metalotionein vezan za jone cinka. Cisteini su obojeni žuto, a cink purpurno. (PDB: 1JJD​)
Identifikatori
SimbolBakterijski metalotionein
PfamPF02069
Pfam klanCL0461
InterProIPR000518

Metalotioneini (MT) su familija cisteinom bogatih proteina male molekulske težine (MW u opsegu od 500 do 14000 Da). Oni su lokalizovani u membrani Golđijevog aparata. Metalotioneini imaju sposobnost vezivanja fizioloških (kao što su cink, bakar, selenijum) i ksenobiotičkih (npr. kadmijum, živa, srebro, arsen) teških metala pomoću tiolnih grupa svojih cisteinskih ostataka, koji predstavljaju skoro 30% njihovih konstituentnih aminokiselinskih ostataka.[2]

Metalotioneine su otkrili 1957. godine Vali i Margoš iz prečišćenog proteina koji vezuje Cd iz konjskog renalnog korteksa.[3] Metalotionein imaju važnu ulogu u zaštiti protiv metalne toksičnosti i oksidativnog stresa, i učestvuju u regulaciji koncentracije cinka i bakra.[4] Postoje četiri glavne izoforme koje su izražene kod ljudi (familija 1, pogledajte tabelu ispod): MT1 (podtipovi A, B, E, F, G, H, L, M, X), MT2, MT3, i MT4. U ljudskom telu, velike količine su sintetisane prvenstveno u jetri i bubrezima. Njihova produkcija je zavisna od dostupnosti dijetarnih minerala kao što su cink, bakar, i selenijum, kao i aminokiselina histidin i cistein.

Struktura i klasifikacija[уреди]

Metalotioneini su prisutni u ogromnom opsegu taksonomskih grupa, od prokariota (kao što je cijanobakterija Synechococcus sp.), protozoa (kao što je cilijatni rod Tetrahymena), biljki (npr. Pisum sativum, Triticum durum, Zea mays, ili Quercus suber), kvasaca (npr. Saccharomyces cerevisiae ili Candida albicans), beskičmenjaka (kao što je nematod Caenorhabditis elegans, insekt Drosophila melanogaster, mekušac Mytilus edulis, ili bodljokožac Strongylocentrotus purpuratus) i kičmenjaka (kao što je kokoška Gallus gallus, ili sisari Homo sapiens ili Mus musculus).

Metalotioneini sa ovog velikog taksonomskog raspona predstavljaju niz visoko heterogenih sekvenci (u pogledu molekulske težine, kao i broja i distribucije Cys ostataka) i oni ne ispoljavaju opštu homologiju. Uprkos toga homologija je nađena unutar pojedinih taksonomskih grupa (kao što su kičmenjački MT molekuli).

Na osnovu njihove primarne strukture, metalotioneini su bili klasifikovani na različite načine. Prvi datira iz 1987, kad su Fauler et al., uspostavili tri MT klase: Klasa I, obuhvata analoge koji su homologni sa konjskim MT, Klasa II, obuhvata preostale MT koji nisu homologni sa konjskim MT, i Klasa III obuhvata fitohelatine, cisteinom bogate enzimatski sintetisane peptide.

Drugu klasifikaciju su izvršili Binz i Kagi 2001. godine, i ona uzima u obzir taksonomske parametre i obrasce distribucije cisteinskih ostataka duž MT sekvence. Ishod ove klasifikacije je set od 15 MT familija. Familija 15 sadrži biljne metalotioneine, koje su 2002. bili dalje klasifikovani Kobet i Goldsbra u 4 tipa (1, 2, 3 i 4) u zavisnosti od distribucije njihovih cisteinskih ostataka i regiona u kojima nema cisteina (zvanih razmaknice), koji su karakteristični za biljne metalotioneine.

Tabela koja obuhvata glavne aspekte dve poslednje klasifikacije.

Familija Ime Obrazac sekvence Primer
1 Kičmenjaci K-x(1,2)-C-C-x-C-C-P-x(2)-C Mus musculus MT1
MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCSCCPVGCAKCAQGCVCKGSSEKCRCCA
2 Mekušci C-x-C-x(3)-C-T-G-x(3)-C-x-C-x(3)-C-x-C-K Mytilus edulis 10MTIV
MPAPCNCIETNVCICDTGCSGEGCRCGDACKCSGADCKCSGCKVVCKCSGSCACEGGCTGPSTCKCAPGCSCK
3 Rakovi P-[GD]-P-C-C-x(3,4)-C-x-C Homarus americanus MTH
MPGPCCKDKCECAEGGCKTGCKCTSCRCAPCEKCTSGCKCPSKDECAKTCSKPCKCCP
4 Bodljokošci P-D-x-K-C-V-C-C-x(5)-C-x-C-x(4)-C-C-x(4)-C-C-x(4,6)-C-C Strongylocentrotus purpuratus SpMTA
MPDVKCVCCKEGKECACFGQDCCKTGECCKDGTCCGICTNAACKCANGCKCGSGCSCTEGNCAC
5 Dvokrilci C-G-x(2)-C-x-C-x(2)-Q-x(5)-C-x-C-x(2)D-C-x-C Drosophila melanogaster MTNB
MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNK
6 Nematode K-C-C-x(3)-C-C Caenorhabditis elegans MT1
MACKCDCKNKQCKCGDKCECSGDKCCEKYCCEEASEKKCCPAGCKGDCKCANCHCAEQKQCGDKTHQHQGTAAAH
7 Trepljari x-C-C-C-x ? Tetrahymena thermophila MTT1
MDKVNSCCCGVNAKPCCTDPNSGCCCVSKTDNCCKSDTKECCTGTGEGCKCVNCKCCKPQANCCCGVNAKPCCFDPNSGCCCVSKTNNCCKSD TKECCTGTGEGCKCTSCQCCKPVQQGCCCGDKAKACCTDPNSGCCCSNKANKCCDATSKQECQTCQCCK
8 Gljivični 1 C-G-C-S-x(4)-C-x-C-x(3,4)-C-x-C-S-x-C Neurospora crassa MT
MGDCGCSGASSCNCGSGCSCSNCGSK
9 Gljivični 2 --- Candida glabrata MT2
MANDCKCPNGCSCPNCANGGCQCGDKCECKKQSCHGCGEQCKCGSHGSSCHGSCGCGDKCECK
10 Gljivični 3 --- Candida glabrata MT2
MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQTCKCQTCKC
11 Gljivični 4 C-X-K-C-x-C-x(2)-C-K-C Yarrowia lipolytica MT3
MEFTTAMLGASLISTTSTQSKHNLVNNCCCSSSTSESSMPASCACTKCGCKTCKC
12 Gljivični 5 --- Saccharomyces cerevisiae CUP1
MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSGK
13 Gljivični 6 --- Saccharomyces cerevisiae CRS5
TVKICDCEGECCKDSCHCGSTCLPSCSGGEKCKCDHSTGSPQCKSCGEKCKCETTCTCEKSKCNCEKC
14 Prokariote K-C-A-C-x(2)-C-L-C Synechococcus sp SmtA
MTTVTQMKCACPHCLCIVSLNDAIMVDGKPYCSEVCANGTCKENSGCGHAGCGCGSA
15 Biljke [YFH]-x(5,25)-C-[SKD]-C-[GA]-[SDPAT]-x(0,1)-C-x-[CYF]
15.1 Biljni MT tip 1 C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3)-spacer-C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3) Pisum sativum MT
MSGCGCGSSCNCGDSCKCNKRSSGLSYSEMETTETVILGVGPAKIQFEGAEMSAASEDGGCKCGDNCTCDPCNCK
15.2 Biljni MT tip 2 C-C-X(3)-C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3)-spacer- C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3) Lycopersicon esculentum MT
MSCCGGNCGCGSSCKCGNGCGGCKMYPDMSYTESSTTTETLVLGVGPEKTSFGAMEMGESPVAENGCKCGSDCKCNPCTCSK
15.3 Biljni MT tip 3 --- Arabidopsis thaliana MT3
MSSNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAEENNANCKCKCGSSCSCVNCTCCPN
15.4 Biljni MT tip 4 ili Ec C-x(4)-C-X-C-X(3)-C-X(5)-C-X-C-X(9,11)-HTTCGCGEHC-X-C-X(20)-CSCGAXCNCASC-X(3,5) Triticum aestivum MT
MGCNDKCGCAVPCPGGTGCRCTSARSDAAAGEHTTCGCGEHCGCNPCACGREGTPSGRANRRANCSCGAACNCASCGSTTA
99 Fitohelatini i drugi neproteinogeni MT --- Schizosaccharomyces pombe
γEC-γEC-γECG

Više podataka o ovoj klasifikaciji je dostupno na Expasy stranici o metalotioneinima.[5]

Reference[уреди]

  1. ^ PDB: 2KAK​; Peroza EA, Schmucki R, Güntert P, Freisinger E, Zerbe O (mart 2009). „The beta(E)-domain of wheat E(c)-1 metallothionein: a metal-binding domain with a distinctive structure”. J. Mol. Biol. 387 (1): 207—18. PMID 19361445. doi:10.1016/j.jmb.2009.01.035. 
  2. ^ Sigel H, Sigel A, ур. (2009). Metallothioneins and Related Chelators (Metal Ions in Life Sciences). Metal Ions in Life Sciences. 5. Cambridge, England: Royal Society of Chemistry. ISBN 1-84755-899-2. 
  3. ^ Margoshes M, Vallee BL (1957). „A cadmium protein from equine kidney cortex”. Journal of the American Chemical Society. 79 (17): 4813—4814. doi:10.1021/ja01574a064. 
  4. ^ Felizola SJ, Nakamura Y, Arata Y, Ise K, Satoh F, Rainey WE, Midorikawa S, Suzuki S, Sasano H (2014). „Metallothionein-3 (MT-3) in the human adrenal cortex and its disorders”. Endocrine Pathology. 25 (3): 229—235. PMID 24242700. doi:10.1007/s12022-013-9280-9. 
  5. ^ „Metallothioneins: classification and list of entries”. www.uniprot.org. 

Literatura[уреди]

  • Sigel H, Sigel A, ур. (2009). Metallothioneins and Related Chelators (Metal Ions in Life Sciences). Metal Ions in Life Sciences. 5. Cambridge, England: Royal Society of Chemistry. ISBN 1-84755-899-2. 
  • Cherian MG, Jayasurya A, Bay BH (decembar 2003). „Metallothioneins in human tumors and potential roles in carcinogenesis”. Mutat. Res. 533 (1–2): 201—9. PMID 14643421. doi:10.1016/j.mrfmmm.2003.07.013. 

Spoljašnje veze[уреди]