Kortikotropin-oslobađajući hormon — разлика између измена
Ред 24: | Ред 24: | ||
== Literatura == |
== Literatura == |
||
{{reflist|2}} |
{{reflist|2}} |
||
==Dodatna literatura== |
|||
{{Refbegin | 2}} |
|||
{{PBB_Further reading |
|||
| citations = |
|||
*{{cite journal | author=Florio P, Severi FM, Ciarmela P, ''et al.'' |title=Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family |journal=Endocrine |volume=19 |issue= 1 |pages= 91–102 |year= 2003 |pmid= 12583606 |doi=10.1385/ENDO:19:1:91 }} |
|||
*{{cite journal | author=Florio P, Rossi M, Sigurdardottir M, ''et al.'' |title=Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A |journal=Steroids |volume=68 |issue= 10–13 |pages= 801–7 |year= 2003 |pmid= 14667971 |doi=10.1016/S0039-128X(03)00137-5 }} |
|||
*{{cite journal | author=Vamvakopoulos NC, Karl M, Mayol V, ''et al.'' |title=Structural analysis of the regulatory region of the human corticotropin releasing hormone gene |journal=FEBS Lett. |volume=267 |issue= 1 |pages= 1–5 |year= 1990 |pmid= 2365075| doi=10.1016/0014-5793(90)80272-K}} |
|||
*{{cite journal | author=Robinson BG, D'Angio LA, Pasieka KB, Majzoub JA |title=Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing |journal=Mol. Cell. Endocrinol. |volume=61 |issue= 2 |pages= 175–80 |year= 1989 |pmid= 2783917| doi=10.1016/0303-7207(89)90128-7}} |
|||
*{{cite journal | author=Arbiser JL, Morton CC, Bruns GA, Majzoub JA |title=Human corticotropin releasing hormone gene is located on the long arm of chromosome 8 |journal=Cytogenet. Cell Genet. |volume=47 |issue= 3 |pages= 113–6 |year= 1988 |pmid= 3259914 |doi=10.1159/000132525 }} |
|||
*{{cite journal | author=Sasaki A, Tempst P, Liotta AS, ''et al.'' |title=Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta |journal=J. Clin. Endocrinol. Metab. |volume=67 |issue= 4 |pages= 768–73 |year= 1988 |pmid= 3262120 |doi=10.1210/jcem-67-4-768 }} |
|||
*{{cite journal | author=Shibahara S, Morimoto Y, Furutani Y, ''et al.'' |title=Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene |journal=EMBO J. |volume=2 |issue= 5 |pages= 775–9 |year= 1984 |pmid= 6605851 |doi= | pmc=555184 }} |
|||
*{{cite journal | author=Behan DP, Heinrichs SC, Troncoso JC, ''et al.'' |title=Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease |journal=Nature |volume=378 |issue= 6554 |pages= 284–7 |year= 1995 |pmid= 7477348 |doi= 10.1038/378284a0 }} |
|||
*{{cite journal | author=Kawahito Y, Sano H, Mukai S, ''et al.'' |title=Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis |journal=Gut |volume=37 |issue= 4 |pages= 544–51 |year= 1996 |pmid= 7489943 |doi=10.1136/gut.37.4.544 | pmc=1382908 }} |
|||
*{{cite journal | author=McLean M, Bisits A, Davies J, ''et al.'' |title=A placental clock controlling the length of human pregnancy |journal=Nat. Med. |volume=1 |issue= 5 |pages= 460–3 |year= 1995 |pmid= 7585095| doi=10.1038/nm0595-460}} |
|||
*{{cite journal | author=Slominski A, Ermak G, Hwang J, ''et al.'' |title=Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin |journal=FEBS Lett. |volume=374 |issue= 1 |pages= 113–6 |year= 1995 |pmid= 7589495| doi=10.1016/0014-5793(95)01090-2}} |
|||
*{{cite journal | author=Sutton SW, Behan DP, Lahrichi SL, ''et al.'' |title=Ligand requirements of the human corticotropin-releasing factor-binding protein |journal=Endocrinology |volume=136 |issue= 3 |pages= 1097–102 |year= 1995 |pmid= 7867564| doi=10.1210/en.136.3.1097}} |
|||
*{{cite journal | author=Vamvakopoulos NC, Chrousos GP |title=Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene |journal=DNA Seq. |volume=4 |issue= 3 |pages= 197–206 |year= 1994 |pmid= 8161822 |doi=10.3109/10425179309015632 }} |
|||
*{{cite journal | author=Perrin MH, Donaldson CJ, Chen R, ''et al.'' |title=Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor |journal=Endocrinology |volume=133 |issue= 6 |pages= 3058–61 |year= 1994 |pmid= 8243338 |doi=10.1210/en.133.6.3058 }} |
|||
*{{cite journal | author=Romier C, Bernassau JM, Cambillau C, Darbon H |title=Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics |journal=Protein Eng. |volume=6 |issue= 2 |pages= 149–56 |year= 1993 |pmid= 8386360 |doi=10.1093/protein/6.2.149 }} |
|||
*{{cite journal | author=Liaw CW, Grigoriadis DE, Lovenberg TW, ''et al.'' |title=Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach |journal=Mol. Endocrinol. |volume=11 |issue= 7 |pages= 980–5 |year= 1997 |pmid= 9178757 |doi=10.1210/me.11.7.980 }} |
|||
*{{cite journal | author=Timpl P, Spanagel R, Sillaber I, ''et al.'' |title=Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1 |journal=Nat. Genet. |volume=19 |issue= 2 |pages= 162–6 |year= 1998 |pmid= 9620773 |doi= 10.1038/520 }} |
|||
*{{cite journal | author=Perone MJ, Murray CA, Brown OA, ''et al.'' |title=Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells |journal=Mol. Cell. Endocrinol. |volume=142 |issue= 1–2 |pages= 191–202 |year= 1998 |pmid= 9783915| doi=10.1016/S0303-7207(98)00104-X}} |
|||
*{{cite journal | author=Willenberg HS, Bornstein SR, Hiroi N, ''et al.'' |title=Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function |journal=Mol. Psychiatry |volume=5 |issue= 2 |pages= 137–41 |year= 2000 |pmid= 10822340| doi=10.1038/sj.mp.4000720}} |
|||
*{{cite journal | author=Saeed B, Fawcett M, Self C |title=Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes |journal=Eur. J. Clin. Invest. |volume=31 |issue= 2 |pages= 125–30 |year= 2001 |pmid= 11168450| doi=10.1046/j.1365-2362.2001.00770.x}} |
|||
}} |
|||
== Spoljašnje veze == |
Верзија на датум 18. јун 2011. у 21:15
Kortikotropin-oslobađajući hormon | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Dostupne strukture | |||||||||||
1go9, 1goe | |||||||||||
Identifikatori | |||||||||||
Simboli | CRH; CRF | ||||||||||
Vanjski ID | OMIM: 122560 MGI: 88496 HomoloGene: 599 GeneCards: CRH Gene | ||||||||||
| |||||||||||
Pregled RNK izražavanja | |||||||||||
podaci | |||||||||||
Ortolozi | |||||||||||
Vrsta | Čovek | Miš | |||||||||
Entrez | 1392 | 12918 | |||||||||
Ensembl | ENSG00000147571 | ENSMUSG00000049796 | |||||||||
UniProt | P06850 | Q14AA2 | |||||||||
RefSeq (mRNA) | NM_000756 | NM_205769 | |||||||||
RefSeq (protein) | NP_000747 | NP_991338 | |||||||||
Lokacija (UCSC) |
Chr 8: 67.25 - 67.25 Mb |
Chr 3: 19.89 - 19.89 Mb | |||||||||
PubMed pretraga | [1] | [2] |
Kortikotropin-oslobađajuči hormon (CRH, originalno nazvan Kortikotropin-oslobađajuči faktor, CRF, takođe poznat kao kortikoliberin), je polipeptidni hormon i neurotransmiter koji učestvuje u responsu na stres. On pripada familiji kortikotropin-oslobađajućih faktorA.
Njegova glavna funkcija je stimulacija hipofizne sinteze ACTH.
Kortikotropin-oslobađajuči hormon je 41-aminokiselina dug peptid izveden iz 191-aminokiselinskog preprohormona. CRH izlučuje paraventrikularni nukleus (PVN) hipotalamusa u odgovoru na stres. Primetno umanjenje CRH koncentracije je bilo primećeno kod obolelih od Alchajmerove bolesti. Osim što se proizvodi u hipotalamusu, CRH je takođe sintetisan u perifernim tkivima, poput T limfocita, i visoko je izražen u posteljici. U posteljici je CRH indikator koji određuje dužinu gestacije i vreme porođaja. Brzo povišenje CRH nivoa u cirkulaciji se javlja na početku porođaja.[1]
Struktura
CRH su otkrili Vale et al. kod ovaca 1981.[2] Njegova sekvenca je:
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
Peptidi pacova i čoveka su identični i razlikuju se od ovčije sekvence za samo 7 aminokiselina.[3]
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Interakcije
Za kortikotropin-oslobađajući hormon je pokazano da interaguje sa kortikotropin-oslobađajućim hormonskim receptorom 1.[4][5]
Vidi još
Literatura
- ^ „Entrez Gene: CRH corticotropin releasing hormone”.
- ^ Vale W, Spiess J, Rivier C, Rivier J (1981). „Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin”. Science (journal). 213 (4514): 1394—7. PMID 6267699. doi:10.1126/science.6267699. Непознати параметар
|month=
игнорисан (помоћ) - ^ Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (1985). „NIH conference. Clinical applications of corticotropin-releasing factor.”. Annals of internal medicine. 102 (3): 344—358. PMID 2982307. Непознати параметар
|month=
игнорисан (помоћ) - ^ Grammatopoulos, D K (1999). „A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes”. Mol. Endocrinol. UNITED STATES. 13 (12): 2189—202. ISSN 0888-8809. PMID 10598591. doi:10.1210/me.13.12.2189. Непознати параметар
|month=
игнорисан (помоћ); Непознати параметар|coauthors=
игнорисан [|author=
се препоручује] (помоћ); Проверите вредност парамет(а)ра за датум:|date=
(помоћ) - ^ Gottowik, J (1997). „Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin”. Neuropharmacology. ENGLAND. 36 (10): 1439—46. ISSN 0028-3908. PMID 9423932. doi:10.1016/S0028-3908(97)00098-1. Непознати параметар
|month=
игнорисан (помоћ); Непознати параметар|coauthors=
игнорисан [|author=
се препоручује] (помоћ); Проверите вредност парамет(а)ра за датум:|date=
(помоћ)
Dodatna literatura
- Florio P, Severi FM, Ciarmela P; et al. (2003). „Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family”. Endocrine. 19 (1): 91—102. PMID 12583606. doi:10.1385/ENDO:19:1:91.
- Florio P, Rossi M, Sigurdardottir M; et al. (2003). „Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A”. Steroids. 68 (10–13): 801—7. PMID 14667971. doi:10.1016/S0039-128X(03)00137-5.
- Vamvakopoulos NC, Karl M, Mayol V; et al. (1990). „Structural analysis of the regulatory region of the human corticotropin releasing hormone gene”. FEBS Lett. 267 (1): 1—5. PMID 2365075. doi:10.1016/0014-5793(90)80272-K.
- Robinson BG, D'Angio LA, Pasieka KB, Majzoub JA (1989). „Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing”. Mol. Cell. Endocrinol. 61 (2): 175—80. PMID 2783917. doi:10.1016/0303-7207(89)90128-7.
- Arbiser JL, Morton CC, Bruns GA, Majzoub JA (1988). „Human corticotropin releasing hormone gene is located on the long arm of chromosome 8”. Cytogenet. Cell Genet. 47 (3): 113—6. PMID 3259914. doi:10.1159/000132525.
- Sasaki A, Tempst P, Liotta AS; et al. (1988). „Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta”. J. Clin. Endocrinol. Metab. 67 (4): 768—73. PMID 3262120. doi:10.1210/jcem-67-4-768.
- Shibahara S, Morimoto Y, Furutani Y; et al. (1984). „Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene”. EMBO J. 2 (5): 775—9. PMC 555184 . PMID 6605851.
- Behan DP, Heinrichs SC, Troncoso JC; et al. (1995). „Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease”. Nature. 378 (6554): 284—7. PMID 7477348. doi:10.1038/378284a0.
- Kawahito Y, Sano H, Mukai S; et al. (1996). „Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis”. Gut. 37 (4): 544—51. PMC 1382908 . PMID 7489943. doi:10.1136/gut.37.4.544.
- McLean M, Bisits A, Davies J; et al. (1995). „A placental clock controlling the length of human pregnancy”. Nat. Med. 1 (5): 460—3. PMID 7585095. doi:10.1038/nm0595-460.
- Slominski A, Ermak G, Hwang J; et al. (1995). „Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin”. FEBS Lett. 374 (1): 113—6. PMID 7589495. doi:10.1016/0014-5793(95)01090-2.
- Sutton SW, Behan DP, Lahrichi SL; et al. (1995). „Ligand requirements of the human corticotropin-releasing factor-binding protein”. Endocrinology. 136 (3): 1097—102. PMID 7867564. doi:10.1210/en.136.3.1097.
- Vamvakopoulos NC, Chrousos GP (1994). „Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene”. DNA Seq. 4 (3): 197—206. PMID 8161822. doi:10.3109/10425179309015632.
- Perrin MH, Donaldson CJ, Chen R; et al. (1994). „Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor”. Endocrinology. 133 (6): 3058—61. PMID 8243338. doi:10.1210/en.133.6.3058.
- Romier C, Bernassau JM, Cambillau C, Darbon H (1993). „Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics”. Protein Eng. 6 (2): 149—56. PMID 8386360. doi:10.1093/protein/6.2.149.
- Liaw CW, Grigoriadis DE, Lovenberg TW; et al. (1997). „Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach”. Mol. Endocrinol. 11 (7): 980—5. PMID 9178757. doi:10.1210/me.11.7.980.
- Timpl P, Spanagel R, Sillaber I; et al. (1998). „Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1”. Nat. Genet. 19 (2): 162—6. PMID 9620773. doi:10.1038/520.
- Perone MJ, Murray CA, Brown OA; et al. (1998). „Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells”. Mol. Cell. Endocrinol. 142 (1–2): 191—202. PMID 9783915. doi:10.1016/S0303-7207(98)00104-X.
- Willenberg HS, Bornstein SR, Hiroi N; et al. (2000). „Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function”. Mol. Psychiatry. 5 (2): 137—41. PMID 10822340. doi:10.1038/sj.mp.4000720.
- Saeed B, Fawcett M, Self C (2001). „Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes”. Eur. J. Clin. Invest. 31 (2): 125—30. PMID 11168450. doi:10.1046/j.1365-2362.2001.00770.x.