Neuromedin B

Из Википедије, слободне енциклопедије
Иди на навигацију Иди на претрагу
neuromedin B
Simbol NMB
Entrez 4828
HUGO 7842
OMIM 162340
RefSeq NM_021077
UniProt P08949
Drugi podaci
Lokus Hromozom 15 q11-qter

Neuromedin B (NMB) je bombesinu srodan peptid kod sisara.[1][2] On je originalno bio izdvojen iz svinjske kičmene moždine, i kasnije je pokazano da je prisutan u humanom humanom nervnom sistemu i gastrointestinalnom traktu.[3]


Sekvenca C-terminalnog dekapeptida je visoko očuvana među sisarskim vrstama: GNLWATGHFM-(NH2). Taj peptid je poznat kao neuromein B, mada je precizniji naziv neuromedin B 23-32. Sekvenca neuromedina B (kod pacova) je: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4]


Neuromedin reguliše sledeće funkcije:


  1. ^ Ohki-Hamazaki H (2000). „Neuromedin B”. Prog. Neurobiol. 62 (3): 297—312. PMID 10840151. doi:10.1016/S0301-0082(00)00004-6. 
  2. ^ Jensen RT, Battey JF, Spindel ER, Benya RV (2008). „International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states”. Pharmacol. Rev. 60 (1): 1—42. PMC 2517428Слободан приступ. PMID 18055507. doi:10.1124/pr.107.07108. 
  3. ^ Krane IM, Naylor SL, Helin-Davis D, Chin WW, Spindel ER (15. 09. 1988). „Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin”. J. Biol. Chem. 263 (26): 13317—23. PMID 2458345. 
  4. ^ Wada E, Way J, Lebacq-Verheyden AM, Battey JF (1. 09. 1990). „Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system”. J. Neurosci. 10 (9): 2917—30. PMID 2398368. 

Spoljašnje veze[уреди]