Kortikotropin-oslobađajući hormon

Kortikotropin-oslobađajući hormon
PDB prikaz baziran na 1go9.
Dostupne strukture
1go9, 1goe
Identifikatori
Simboli CRH; CRF
Vanjski ID OMIM122560 MGI88496 HomoloGene599 GeneCards: CRH Gene
Pregled RNK izražavanja
PBB GE CRH 205630 at tn.png
PBB GE CRH 205629 s at tn.png
podaci
Ortolozi
Vrsta Čovek Miš
Entrez 1392 12918
Ensembl ENSG00000147571 ENSMUSG00000049796
UniProt P06850 Q14AA2
RefSeq (mRNA) NM_000756 NM_205769
RefSeq (protein) NP_000747 NP_991338
Lokacija (UCSC) Chr 8:
67.25 - 67.25 Mb
Chr 3:
19.89 - 19.89 Mb
PubMed pretraga [1] [2]

Kortikotropin-oslobađajući hormon (CRH, originalno nazvan kortikotropin-oslobađajući faktor, CRF, takođe poznat kao kortikoliberin), je polipeptidni hormon i neurotransmiter koji učestvuje u odgovoru organizma na stres. On pripada familiji kortikotropin-oslobađajućih faktora.

Njegova glavna funkcija je stimulacija hipofizne sinteze adrenokortikotropnog hormona.

Kortikotropin-oslobađajuči hormon je 41-aminokiselina dug peptid izveden iz 191-aminokiselinskog preprohormona. CRH izlučuje paraventrikularni nukleus (PVN) hipotalamusa u odgovoru na stres. Primetno umanjenje CRH koncentracije je bilo primećeno kod obolelih od Alchajmerove bolesti. Osim što se proizvodi u hipotalamusu, CRH je takođe sintetisan u perifernim tkivima, poput T limfocita, i visoko je izražen u posteljici. U posteljici je CRH služi kao indikator koji određuje dužinu gestacije i vreme porođaja. Brzo povišenje CRH nivoa u cirkulaciji se javlja na početku porođaja.[1]

Struktura[уреди | уреди извор]

CRH su otkrili Vale et al. kod ovaca 1981.[2] Njegova sekvenca je:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Peptidi pacova i čoveka su identični i razlikuju se od ovčije sekvence za samo 7 aminokiselina.[3]

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Interakcije[уреди | уреди извор]

Za kortikotropin-oslobađajući hormon je pokazano da interaguje sa kortikotropin-oslobađajućim hormonskim receptorom 1.[4][5]

Vidi još[уреди | уреди извор]

Reference[уреди | уреди извор]

  1. ^ „Entrez Gene: CRH corticotropin releasing hormone”. 
  2. ^ Vale W, Spiess J, Rivier C, Rivier J (1981). „Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin”. Science (journal). 213 (4514): 1394—7. PMID 6267699. doi:10.1126/science.6267699. 
  3. ^ Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (1985). „NIH conference. Clinical applications of corticotropin-releasing factor.”. Annals of internal medicine. 102 (3): 344—358. PMID 2982307. 
  4. ^ Grammatopoulos, D K; Dai Y; et al. (1999). „A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes”. Mol. Endocrinol. UNITED STATES. 13 (12): 2189—202. ISSN 0888-8809. PMID 10598591. doi:10.1210/me.13.12.2189. 
  5. ^ Gottowik, J; Goetschy V; et al. (1997). „Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin”. Neuropharmacology. ENGLAND. 36 (10): 1439—46. ISSN 0028-3908. PMID 9423932. doi:10.1016/S0028-3908(97)00098-1. 

Literatura[уреди | уреди извор]

Spoljašnje veze[уреди | уреди извор]

Star of life.svgMolimo Vas, obratite pažnju na važno upozorenje
u vezi sa temama iz oblasti medicine (zdravlja).